Hibiscus syriacus (Rose-of-Sharon): 120163304 Help Entry 120163304         CDS       T09559                                  Name (RefSeq) probable histone H2A.5   KO K11251   histone H2A Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120163304  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hsyr03036]     120163304   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsyr04147]     120163304 Chromosome and associated proteins [BR:hsyr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120163304 Exosome [BR:hsyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120163304 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Cdc6_lid Motif Other DBs NCBI-GeneID:  120163304 NCBI-ProteinID:  XP_039029204 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search METTSKPTGGRKKAVSKSAKAGLRFAVGRVARYLKKGRYAQRCGRGASVYLAAVLEYLAA EVLELAGNAARDNMRKRINPRHVYIAVQRLKNGVIG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggaaacgacgtcaaagccaacgggaggccggaaaaaggcggtttctaagtcggcaaag gccggactccgcttcgcggtgggtcgggttgcccgctacctcaagaaaggccgttatgca cagcgttgcggccgtggcgcttccgtctatctcgctgccgtccttgagtaccttgctgct gaggtgttggaattggcggggaatgcggcacgtgacaacatgaggaagaggatcaatcca cgacacgtgtatatagctgtgcagcggttaaaaaatggtgtgatcggttaa

DBGET integrated database retrieval system