Hibiscus syriacus (Rose-of-Sharon): 120168980 Help Entry 120168980         CDS       T09559                                  Name (RefSeq) rac-like GTP-binding protein 6   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr04145   Phagosome hsyr04148   Efferocytosis hsyr04620   Toll-like receptor signaling pathway hsyr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:hsyr00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     120168980    04148 Efferocytosis     120168980  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120168980  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     120168980  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsyr04131]     120168980   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsyr04147]     120168980    04031 GTP-binding proteins [BR:hsyr04031]     120168980 Membrane trafficking [BR:hsyr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     120168980  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     120168980   Macropinocytosis    Ras GTPases     120168980  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     120168980 Exosome [BR:hsyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120168980   Exosomal proteins of other body fluids (saliva and urine)    120168980   Exosomal proteins of colorectal cancer cells    120168980   Exosomal proteins of bladder cancer cells    120168980 GTP-binding proteins [BR:hsyr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     120168980 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf B12-binding Motif Other DBs NCBI-GeneID:  120168980 NCBI-ProteinID:  XP_039033150 LinkDB All DBs Position Unknown AA seq 196 aa AA seqDB search MGASKFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANIVVDGSIVNIGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELKHYAPGVPIVLVGTKI DLREDEQFLNDHPNAIPITTAQGEELKKQIGSSYYIECSSKTQQNVKAVFDAAIKVVLQP PKNKQKSNGGGVCSVL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgggcgcgtcgaaattcattaagtgcgtcaccgtcggcgacggtgccgttggcaagacg tgcttgctgatttcctacaccagcaacactttccctacggactatgtcccgactgttttc gacaatttcagtgcgaatatcgtcgttgatggcagcattgtcaacataggcttatgggat actgctggtcaggaggattacaatagactgagaccattgagctatcgtggtgccgatgtc tttattcttgcattttctctcatcagcaaggctagttacgaaaacgttgcgaagaagtgg attcctgaattaaagcattatgcacctggcgttccaatcgtccttgttggaactaagatc gatctccgggaggatgagcaattcctcaatgaccatcctaatgcaataccaattactaca gctcagggagaggagttaaagaaacagatagggtcttcttactacatcgagtgtagttca aaaacccagcagaatgtgaaggcagtgtttgatgcggctatcaaggtagtgcttcagcct ccgaaaaacaagcaaaagtcgaatggcggcggcgtttgctcggtattgtga

DBGET integrated database retrieval system