Hibiscus syriacus (Rose-of-Sharon): 120170423 Help Entry 120170423         CDS       T09559                                  Name (RefSeq) protein MHF1 homolog   KO K11511   centromere protein S Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     120170423  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hsyr03036]     120170423    03400 DNA repair and recombination proteins [BR:hsyr03400]     120170423 Chromosome and associated proteins [BR:hsyr03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      120170423 DNA repair and recombination proteins [BR:hsyr03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      120170423 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Motif Other DBs NCBI-GeneID:  120170423 NCBI-ProteinID:  XP_039034285 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MEIDVGRSDFEKDEEEDDDSVSDLLRDRFHLSAISIAEYEAKRNGMEISQPIVACIADLA FKYTGLLVKDLELFSHHTGRKSVTMGDVIVSAHRNKHFLRLLRSFRNELKANEPQCERKR KK NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggaaatcgatgtaggtaggagcgatttcgagaaagatgaagaggaagacgatgactca gtttctgatctcttgagagatcgctttcatctctctgccatctccatcgccgaatacgaa gctaagagaaacggtatggagatttctcaaccaattgtagcttgcatcgccgatttggcc ttcaaatacacaggtctgctagtaaaggaccttgagctattttcacaccacactggtcgt aaatccgtgaccatgggagatgtcatagtttctgctcatagaaataaacattttctgcgt ctgttgaggtccttccggaatgagcttaaagcaaatgaaccccaatgtgaaaggaagagg aagaaa

DBGET integrated database retrieval system