Hibiscus syriacus (Rose-of-Sharon): 120172465 Help Entry 120172465         CDS       T09559                                  Name (RefSeq) sm-like protein LSM7 isoform X1   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03018   RNA degradation hsyr03040   Spliceosome Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     120172465   09123 Folding, sorting and degradation    03018 RNA degradation     120172465  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hsyr03019]     120172465    03041 Spliceosome [BR:hsyr03041]     120172465 Messenger RNA biogenesis [BR:hsyr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      120172465   mRNA degradation factors    5'-3' decay     Lsm complex      120172465 Spliceosome [BR:hsyr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     120172465 SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  120172465 NCBI-ProteinID:  XP_039035848 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MSGRKETVLDLAKFVDKGVQVKLTGGRQALQYVMCPRFTGTLKGYDQLLNLVLDEAVEFL RDQDDPLKTTDQTRRLGLIVCRGTAVMLVSPTDGTDEIANPFIQPDGA NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgtcgggaaggaaagaaactgtcttggatttggctaagtttgtggacaaaggtgtgcag gtcaaactcactggtggtagacaagcattgcaatatgtcatgtgccctagattcacaggg accctaaaaggatatgaccaactactaaatcttgtcctggatgaagctgtagagtttctc cgagaccaggatgatccattgaagactactgatcagactaggcgtcttggcttgatagtt tgtaggggcacagcggttatgctggtgtcgccaactgatggcacggatgagattgccaat cctttcatccagccagatggagcctga

DBGET integrated database retrieval system