Hibiscus syriacus (Rose-of-Sharon): 120180495 Help Entry 120180495         CDS       T09559                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A [EC:3.6.5.2] Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr04142   Lysosome biogenesis hsyr04144   Endocytosis hsyr04145   Phagocytosis hsyr04148   Efferocytosis Brite KEGG Orthology (KO) [BR:hsyr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120180495    04145 Phagocytosis     120180495    04142 Lysosome biogenesis     120180495    04148 Efferocytosis     120180495  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsyr04131]     120180495   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsyr04147]     120180495    04031 GTP-binding proteins [BR:hsyr04031]     120180495 Enzymes [BR:hsyr01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.5  Acting on GTP to facilitate cellular and subcellular movement     3.6.5.2  small monomeric GTPase      120180495 Membrane trafficking [BR:hsyr04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     120180495  Endosome - Golgi transport     120180495 Exosome [BR:hsyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120180495   Exosomal proteins of other body fluids (saliva and urine)    120180495   Exosomal proteins of colorectal cancer cells    120180495   Exosomal proteins of bladder cancer cells    120180495 GTP-binding proteins [BR:hsyr04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     120180495 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU ATP_bind_1 Septin RsgA_GTPase cobW AAA_16 PduV-EutP nSTAND3 AAA_7 AAA_22 DAP3 NACHT AAA_24 NB-ARC NTPase_1 MCM Sigma54_activat nSTAND1 AAA_14 Motif Other DBs NCBI-GeneID:  120180495 NCBI-ProteinID:  XP_039041741 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MSMRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHDEFLKQANPTDPRTFPF ALLGNKIDVDGGNSRVVSEKKAKDWCASKGNMHYFETSAKEDINVDAAFLCIAKNALANE REQDIYFQGIPEAVTETEQSGGCAC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtcaatgcgaagacgaaccttgctcaaggtcattgttctcggcgacagcggggtgggc aagacgtcgttgatgaatcaatatgttcataagaagttcagtcagcaatataaagcaaca attggtgctgattttgtcactaaggaactacagattgatgatcgccttgtcactctgcag atatgggatactgcaggacaggagcgattccagagtctcggagttgccttttataggggt gcagattgctgtgtcctagtttacgatgttaatgttatgaaatcattcgacacccttgat aactggcatgatgagtttcttaagcaggcaaatccaactgatcccaggacgtttcccttt gcgttgcttggaaacaagatagatgtagatggcggtaatagtcgagtggtctccgagaag aaagcaaaagactggtgtgcttctaaaggaaacatgcattactttgaaacatcagcaaaa gaagatatcaatgttgatgctgcattcctttgtattgccaaaaatgctctagcaaatgag cgagagcaggacatatacttccagggcataccagaggctgtgaccgagaccgaacaaagt ggtggttgtgcatgttga

DBGET integrated database retrieval system