Hibiscus syriacus (Rose-of-Sharon): 120190507 Help Entry 120190507         CDS       T09559                                  Name (RefSeq) rac-like GTP-binding protein 6   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr04145   Phagosome hsyr04148   Efferocytosis hsyr04620   Toll-like receptor signaling pathway hsyr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:hsyr00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     120190507    04148 Efferocytosis     120190507  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120190507  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     120190507  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsyr04131]     120190507   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsyr04147]     120190507    04031 GTP-binding proteins [BR:hsyr04031]     120190507 Membrane trafficking [BR:hsyr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     120190507  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     120190507   Macropinocytosis    Ras GTPases     120190507  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     120190507 Exosome [BR:hsyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120190507   Exosomal proteins of other body fluids (saliva and urine)    120190507   Exosomal proteins of colorectal cancer cells    120190507   Exosomal proteins of bladder cancer cells    120190507 GTP-binding proteins [BR:hsyr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     120190507 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  120190507 NCBI-ProteinID:  XP_039049516 LinkDB All DBs Position Unknown AA seq 195 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELKHYAPGVPIVLVGTKL DLRDDQQFLTDHPNAVPISAAQGEELKKQIGAPAYIECSSKTQQNVKGVFDAAIKVVLQP PNKNKKKKAGSCSIL NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctcgaggttcataaaatgcgtcactgtcggcgatggcgctgtcggaaagacc tgcttgctgatttcctacaccagcaacactttccctacggactatgtcccaactgttttc gacaatttcagtgcaaatgttgtcgtggatggcagcactgtcaacttaggtttatgggat actgctggtcaagaggattacaatagattacgaccactgagctatcgtggggctgatgtc tttattcttgcattttctctcatcagcaaggccagttatgaaaatgttgccaagaagtgg attcctgaactaaagcattatgcacctggtgttccgatcgttcttgttggaactaagctt gatctccgtgatgatcaacaattcttaacagaccatcctaacgcagtccccatttctgct gcccaaggagaggaattaaagaaacagattggggctcctgcatacatcgagtgtagctca aaaacacagcagaatgtgaagggagtctttgatgcagccattaaggtagtgctccagcct ccgaataaaaacaagaagaaaaaagcaggtagttgctcaatattgtga

DBGET integrated database retrieval system