Hibiscus syriacus (Rose-of-Sharon): 120191241 Help Entry 120191241         CDS       T09559                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr04144   Endocytosis hsyr04145   Phagosome hsyr04148   Efferocytosis Brite KEGG Orthology (KO) [BR:hsyr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120191241    04145 Phagosome     120191241    04148 Efferocytosis     120191241  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsyr04131]     120191241   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsyr04147]     120191241    04031 GTP-binding proteins [BR:hsyr04031]     120191241 Membrane trafficking [BR:hsyr04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     120191241 Exosome [BR:hsyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120191241   Exosomal proteins of other body fluids (saliva and urine)    120191241   Exosomal proteins of colorectal cancer cells    120191241   Exosomal proteins of bladder cancer cells    120191241 GTP-binding proteins [BR:hsyr04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     120191241 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc MMR_HSR1 DAP3 RsgA_GTPase Septin AAA_22 AAA_16 nSTAND3 AAA_24 AAA_7 NACHT cobW AAA_5 PduV-EutP IIGP Arf MCM nSTAND1 Sigma54_activat Motif Other DBs NCBI-GeneID:  120191241 NCBI-ProteinID:  XP_039050144 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MSLQKRTLLKVIVLGDSGVGKTSLMNQYVHMKFSQQYKATIGADFVTKELQIDERNVTPS CFFSFIIIMIHFDCFHVLYRLNLKGFLDWIDMGYCRAGKVQSLGVAFYRGADCCVLVYDV NVMKSFDNLDNWHEEFLKQANPTDPKTFPFILLGNR NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcattgcaaaagcgaaccttgctcaaggtcatcgttctcggcgatagcggggtgggc aaaacgtcgttgatgaatcaatatgttcatatgaagtttagtcagcaatataaagcaacc attggtgcagattttgtcactaaagaactccagattgacgaacgcaatgtcactccaagt tgtttcttttcctttattattattatgattcattttgattgtttccatgttctttataga ttaaatttgaagggctttttggattggatagatatgggatactgcagggcaggaaaggtt cagagccttggagttgctttctatagaggtgcagattgttgtgtgctagtctatgatgtt aatgtgatgaaatcatttgataaccttgataattggcatgaggagtttcttaaacaggca aatcctaccgaccccaagacgtttccatttatattgcttggaaacagatag

DBGET integrated database retrieval system