Hibiscus syriacus (Rose-of-Sharon): 120198496 Help Entry 120198496         CDS       T09559                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03018   RNA degradation hsyr03040   Spliceosome Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     120198496   09123 Folding, sorting and degradation    03018 RNA degradation     120198496  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hsyr03019]     120198496    03041 Spliceosome [BR:hsyr03041]     120198496 Messenger RNA biogenesis [BR:hsyr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      120198496   mRNA degradation factors    5'-3' decay     Lsm complex      120198496 Spliceosome [BR:hsyr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     120198496 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  120198496 NCBI-ProteinID:  XP_039055753 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MNNIEKEAVFLDTLSLSESFPFCTETISIITNDGRNIVGVLKGFDQATNIILDESHERVY STKEGVQQLVLGFYIIRGDNISVVGELDEELDSSLDLQTLEHTLLRLLSID NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgaacaacattgaaaaagaagcagtgtttttagacactctctctctctctgaatcattt ccgttctgcacagagacgatctcgatcattaccaatgatggacgcaacattgtgggagtt ttaaaaggctttgaccaggctacaaatatcattctcgacgaatcacatgaacgtgtgtac tccaccaaggaaggtgttcagcaacttgtgttgggtttttacataataagaggcgacaac ataagtgtagtaggtgaactagacgaggagctcgattcctctcttgacttgcaaacctta gagcacaccctcttaaggctgttatccattgattga

DBGET integrated database retrieval system