Hibiscus syriacus (Rose-of-Sharon): 120217434 Help Entry 120217434         CDS       T09559                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Brite KEGG Orthology (KO) [BR:hsyr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:hsyr03041]     120217434   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hsyr04052]     120217434 Spliceosome [BR:hsyr03041]  Complex B   Other components    Complex B specific factors     120217434 Cytokines and neuropeptides [BR:hsyr04052]  Neuropeptides   Unclassified    120217434 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Rad60-SLD Ubiquitin_4 Motif Other DBs NCBI-GeneID:  120217434 NCBI-ProteinID:  XP_039070456 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYTVYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtattgaacgatcgtctaggcaagaaggtgcgcgtgaagtgcaacgac gacgacaccatcggagacctcaagaagcttgttgcggcgcaaaccggaacccgagccgac aagatccgtatccagaagtggtacacggtttacaaggaccatatcaccctcaaggattac gagatccatgatggcatggggctcgaactatactacaattaa

DBGET integrated database retrieval system