Herbaspirillum seropedicae Z67: ACP92_09595 Help Entry ACP92_09595       CDS       T04519                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hsz  Herbaspirillum seropedicae Z67 Pathway hsz01100   Metabolic pathways hsz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hsz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACP92_09595    00074 Mycolic acid biosynthesis     ACP92_09595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACP92_09595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 MAP DUF1493 Motif Other DBs NCBI-ProteinID:  AKN65467 LinkDB All DBs Position 2183261..2183500 Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVAEADIKNESSFVDDLGADSLDTVELVMALEDEFEMEIPDEQA EKITTVQQAIDYAKSQVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgatatcgaacaacgcgtgaagaagatcgtcgctgagcaactgggcgtcgccgaa gccgacatcaagaacgaatcgtcgttcgtggacgacctgggcgccgactcgctggacacc gtcgagctggtcatggcgctggaagatgagttcgaaatggaaatccccgacgaacaagcc gaaaagatcaccaccgtgcaacaggcgatcgattacgccaagtcgcaagtcaaggcctga

DBGET integrated database retrieval system