Haloarcula taiwanensis: BVU17_14195 Help Entry BVU17_14195       CDS       T05292                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hta  Haloarcula taiwanensis Pathway hta03010   Ribosome Brite KEGG Orthology (KO) [BR:hta00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     BVU17_14195   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     BVU17_14195  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hta03011]     BVU17_14195    04121 Ubiquitin system [BR:hta04121]     BVU17_14195   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hta04147]     BVU17_14195 Ribosome [BR:hta03011]  Ribosomal proteins   Eukaryotes    Small subunit     BVU17_14195   Archaea     BVU17_14195 Ubiquitin system [BR:hta04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    BVU17_14195 Exosome [BR:hta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    BVU17_14195   Exosomal proteins of colorectal cancer cells    BVU17_14195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e FYVE Cas12f1-like_TNB Zn_ribbon_RPB9 Zn_ribbon_3 DZR DZR_2 Auto_anti-p27 Zn_ribbon_RPAB4 zf_UBZ Zn-ribbon_GIR1 zf-C2H2_FBX41 CpXC Zn_Ribbon_TF Motif Other DBs NCBI-ProteinID:  AUG48617 UniProt:  A0A2H5A1R2 LinkDB All DBs Position I:2786068..2786202 Genome browser AA seq 44 aa AA seqDB search MPHNEYYNDDGELDRETCPRCGDTVLAEHEDRQHCGKCGYTEWK NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgccacacaacgagtactacaacgacgacggcgaactcgaccgcgagacctgtccccgg tgtggcgacaccgtcctcgccgaacacgaggaccgccagcactgcgggaagtgcggctac accgagtggaagtaa

DBGET integrated database retrieval system