Hydrogenobacter thermophilus: Hydth_0242 Help Entry Hydth_0242        CDS       T02106                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hte  Hydrogenobacter thermophilus Pathway hte01100   Metabolic pathways hte01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hte00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Hydth_0242    00074 Mycolic acid biosynthesis     Hydth_0242   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Hydth_0242 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L50 PP-binding_2 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  ADO44649 UniProt:  D3DFW0 LinkDB All DBs Position 250082..250318 Genome browser AA seq 78 aa AA seqDB search MDLEQKVKEIIADQLGVEVEKLSPEAKFVEDLGADSLDVVELIMAFEEEFGIEIPDEDAE KIRTVGDVLNYLKEKVKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggatttagaacagaaggttaaggagataatagcggatcagttgggagttgaggtggaa aaactaagcccagaagccaaatttgttgaggatttgggggctgattctcttgatgtggtg gaacttataatggcttttgaagaggagtttggcattgagataccagatgaggatgcggag aagataagaacagtaggagatgtgctcaattaccttaaagaaaaagtaaagggctaa

DBGET integrated database retrieval system