Hydrogenobacter thermophilus: Hydth_1325
Help
Entry
Hydth_1325 CDS
T02106
Name
(GenBank) ubiquinol-cytochrome c reductase, iron-sulfur subunit
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
hte
Hydrogenobacter thermophilus
Pathway
hte00190
Oxidative phosphorylation
hte01100
Metabolic pathways
hte02020
Two-component system
hte04148
Efferocytosis
Module
hte_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
hte00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
Hydth_1325
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
Hydth_1325
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
Hydth_1325
Enzymes [BR:
hte01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
Hydth_1325
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Rieske
UCR_Fe-S_N
Aha1_N
Motif
Other DBs
NCBI-ProteinID:
ADO45711
UniProt:
D3DIY4
LinkDB
All DBs
Position
complement(1212975..1213493)
Genome browser
AA seq
172 aa
AA seq
DB search
MEASRRDLISLAIGGLGVVGVAGVLYPIIKTLAPSAASLAAAKVEVDISQIPEGTVRVVS
WKGKPVFVVHLPTNFQWNGTTKEDKNRKLLEGHSAYALIAVCTHLGCIPLWKPQGEAEYN
YPVFHCPCHGGFYSPWGDNIAGPPPLPLHIPPQNLQGNKLVIGEPGFIKEQT
NT seq
519 nt
NT seq
+upstream
nt +downstream
nt
atggaagcctcaaggagagacctcataagtcttgccataggcgggctgggagtagtgggt
gttgcaggggttttgtatcccataattaagactcttgctcccagtgccgcatccttagct
gctgctaaggtggaagtggacatatcacaaatcccggaagggactgtaagggtggtctca
tggaagggcaagcctgttttcgtggtgcatctgcccaccaacttccagtggaacggtact
accaaggaggataaaaacagaaaacttcttgaggggcacagtgcttatgctctcatagcg
gtttgcacgcatcttggatgcattcctctttggaaacctcagggtgaagctgaatacaac
tatccagtctttcactgtccctgtcatggaggcttttactcaccgtggggtgataacata
gcgggtcctcctcctttgcctcttcacataccaccccagaatcttcaaggtaataagctg
gtcataggtgaacccggatttataaaagaacaaacctga
DBGET
integrated database retrieval system