Hydrogenobacter thermophilus: HTH_1669 Help Entry HTH_1669          CDS       T01167                                  Name (GenBank) hypothetical protein   KO K03573   DNA mismatch repair protein MutH Organism hth  Hydrogenobacter thermophilus Pathway hth03430   Mismatch repair Brite KEGG Orthology (KO) [BR:hth00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     HTH_1669  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:hth03400]     HTH_1669 DNA repair and recombination proteins [BR:hth03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Strand discrimination factor      HTH_1669 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MvaI_BcnI CysS_C MutH Motif Other DBs NCBI-ProteinID:  BAI70116 UniProt:  D3DJW4 LinkDB All DBs Position 1520855..1521112 Genome browser AA seq 85 aa AA seqDB search MERKDALEKGKQLIGKDLRELADKLGITVFKREKNKRKKNKGWAGHVIERYLGLPLNSAQ SPDFGSWELKVVSLKYLKSGELTVK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaaagaaaagatgctttagaaaaaggtaaacagctaataggaaaagacttgagagag cttgcagataaattggggattactgtattcaaaagagagaaaaataaaagaaagaaaaat aaaggttgggctggacatgttattgaaagatatttggggcttcctttaaattccgctcag tctcctgactttggttcttgggaattaaaagtagtatcgttaaaatacttaaagtctgga gaattaactgttaaataa

DBGET integrated database retrieval system