Hydrogenophilus thermoluteolus: HPTL_0336
Help
Entry
HPTL_0336 CDS
T05630
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adaptor protein ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
htl
Hydrogenophilus thermoluteolus
Brite
KEGG Orthology (KO) [BR:
htl00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
HPTL_0336 (clpS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Motif
Other DBs
NCBI-ProteinID:
BBD76604
UniProt:
A0A2Z6DVZ0
LinkDB
All DBs
Position
complement(375864..376172)
Genome browser
AA seq
102 aa
AA seq
DB search
MSVQPVEHIEPQAAETELKPPPLFKVLLLNDDFTPMDFVVEVLQRFFHMNTERAVAIMLK
VHHEGMAVCGVYPKDIAATKVAQVTEFARKNGHPLACTMEEA
NT seq
309 nt
NT seq
+upstream
nt +downstream
nt
atgagcgtgcaaccggtcgagcacattgaaccgcaggcggcggaaaccgaactcaagccg
ccgccgctcttcaaggtgctgctgctcaacgacgatttcacgccaatggacttcgtggtg
gaagtgctgcagcgtttttttcacatgaacacggaacgcgcagtcgcaatcatgctcaaa
gtccaccatgaagggatggccgtctgcggggtctacccgaaagacatcgccgccaccaaa
gtggcgcaagtcaccgagttcgcccgcaagaacggccatccattggcctgcaccatggag
gaagcctag
DBGET
integrated database retrieval system