KEGG   Hydrogenophilus thermoluteolus: HPTL_1035
Entry
HPTL_1035         CDS       T05630                                 
Symbol
thrC
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
htl  Hydrogenophilus thermoluteolus
Pathway
htl00260  Glycine, serine and threonine metabolism
htl00750  Vitamin B6 metabolism
htl01100  Metabolic pathways
htl01110  Biosynthesis of secondary metabolites
htl01120  Microbial metabolism in diverse environments
htl01230  Biosynthesis of amino acids
Module
htl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:htl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPTL_1035 (thrC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPTL_1035 (thrC)
Enzymes [BR:htl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPTL_1035 (thrC)
SSDB
Motif
Pfam: Thr_synth_N PALP THR4_C
Other DBs
NCBI-ProteinID: BBD77299
UniProt: A0A2Z6DY79
LinkDB
Position
1097239..1098684
AA seq 481 aa
MHYLSTRGQAPQRRFTDILLEGLASDGGLYVPEYYPQFSLAALEQMAVMPYAELAYTILS
AFAPEIPSDDLAKLVLETYHAARYPYARESVRAARVAPLTWLEPGRFGILELSNGPTLAF
KDMAMQLLGALFEYVLTQRDTYLNILGATSGDTGSAAEHAMRGRARIRVFMLSPAGRMSP
FQRAQMYSLQDENIHNIAIRGAFDDAQDVVKALGADQAFKSQYRLGAVNSINWARIAAQV
VYYFAGYFQAVGRVGDPMSFAVPSGNFGNILAGHIARMMGLPIAQLILATNENNVLDEFF
RTGVYRPRRSDETFVTSSPSMDISKASNFERFVFDLVGRDSQALTTLWRQLAEKGAFDLK
TTPYWATSGRFGFVSGANSHEGRVATIRSIWKRYRVLIDPHTADGVRVAQQVADSRYPVV
VLETAQPAKFADTIQEAVGFAPPRPAPFEGIEAAPQRVTELPADAQAVRRYIEAHALRGR
D
NT seq 1446 nt   +upstreamnt  +downstreamnt
gtgcactacctatcgacacgtggtcaagcaccacaacgacgatttaccgatattcttctc
gaagggcttgccagcgacggtggcctttacgttccggagtactatccgcaattttccctt
gcggcgctcgagcagatggctgtaatgccgtatgcggagttggcctataccatcctatcg
gcatttgcgcccgaaattccttccgatgatttggcgaaactcgttttggaaacctatcac
gcagcgcgctatccctatgcgcgggaatcggtgcgtgctgcccgtgttgcgccgctgact
tggttggagcccgggcgcttcgggattctcgagctttcgaatggcccgacccttgcgttc
aaggatatggcgatgcagctgttgggcgcgctgttcgaatatgttctgacccaacgcgac
acctatctcaatattttgggtgcaacctccggtgatactggttccgccgcggaacatgca
atgcgagggcgtgcacgcatccgcgtcttcatgctttcgccggcggggcggatgagcccg
tttcaacgggcacagatgtatagcctccaggatgaaaacatccacaacattgcgattcgc
ggcgcgttcgacgatgcgcaggatgtggtcaaggcgctgggtgcggatcaggcattcaag
tcccaataccgtttgggcgcggtcaattcgatcaactgggcacgtattgcggcacaggtg
gtctattattttgccggttacttccaggctgtcggtcgcgtcggcgatcccatgagtttt
gccgttcccagcggcaattttggcaatattctggccggtcatatcgcccggatgatgggg
ttgccgattgcacaactcattttggcgacaaacgaaaacaacgttctggacgaatttttc
cgcactggcgtttatcgcccccgccgatcggacgagacttttgtcacttcgagcccgtcg
atggacatttcgaaagcgtctaatttcgaacggttcgttttcgatctggtcgggcgcgat
tcccaagcactcacaacattgtggcgtcaattggcggaaaaaggggcgttcgatcttaaa
acgaccccgtattgggcgacgagcggccgcttcggatttgtctctggtgccaacagccac
gaagggcgtgtggcaacgatccgctcgatctggaagcgctaccgtgtattgatcgatccg
cacacagcagatggggttcgcgtcgcgcagcaggtggccgattcccgctatcccgtcgtc
gttctcgaaaccgcacaaccggcgaagtttgctgatacgattcaagaggcggtgggtttt
gcgccgccacggccagcgccgttcgaagggatcgaagcggcgccgcagcgagtgaccgag
ttgcctgccgacgcgcaggcggtgcggcgctatatcgaagcgcatgcactgaggggacgc
gactaa

DBGET integrated database retrieval system