Hydrogenimonas thermophila: RZR91_00580 Help Entry RZR91_00580       CDS       T09456                                  Name (GenBank) 4Fe-4S binding protein   KO K28729   pyruvate synthase (flavodoxin) subunit D [EC:1.2.8.1] Organism htm  Hydrogenimonas thermophila Pathway htm00010   Glycolysis / Gluconeogenesis htm00020   Citrate cycle (TCA cycle) htm00620   Pyruvate metabolism htm00633   Nitrotoluene degradation htm00640   Propanoate metabolism htm00650   Butanoate metabolism htm00680   Methane metabolism htm00720   Other carbon fixation pathways htm01100   Metabolic pathways htm01110   Biosynthesis of secondary metabolites htm01120   Microbial metabolism in diverse environments htm01200   Carbon metabolism Module htm_M00173   Reductive citrate cycle (Arnon-Buchanan cycle) Brite KEGG Orthology (KO) [BR:htm00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     RZR91_00580    00020 Citrate cycle (TCA cycle)     RZR91_00580    00620 Pyruvate metabolism     RZR91_00580    00640 Propanoate metabolism     RZR91_00580    00650 Butanoate metabolism     RZR91_00580   09102 Energy metabolism    00720 Other carbon fixation pathways     RZR91_00580    00680 Methane metabolism     RZR91_00580   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     RZR91_00580 Enzymes [BR:htm01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.8  With a flavin or flavoprotein as acceptor     1.2.8.1  pyruvate synthase (flavodoxin)      RZR91_00580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_10 Fer4_2 Fer4_6 Fer4_7 Fer4_9 Fer4_15 Fer4_4 Fer4_16 Fer4_13 LdpA_Fe-S-bd Fer4_17 Fer4_8 Fer4_3 Fer4_18 Motif Other DBs NCBI-ProteinID:  WOE70095 LinkDB All DBs Position 115409..115795 Genome browser AA seq 128 aa AA seqDB search MKYLGWDELVPGAILFSFDKELEKDASEILPEDRPYAETNSYTAYVGDWRVLKPVYNRDL CIDCQFCWIYCPDISIISRDKKMIGVDYDHCKGCGICVEVCPTNPKSLLMFEERIDNDEA LAQWPEKE NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgaaatatcttggatgggatgaacttgtcccgggggctattctcttttcatttgataaa gaacttgaaaaggatgcatcagaaattttaccagaagatagaccatatgcagaaacaaac tcttatacagcatatgttggagattggcgagttttaaaacctgtttataaccgtgatctt tgtatagattgtcagttctgctggatctattgtcctgatatttcgattatttcaagagat aaaaagatgattggtgttgattatgaccattgtaaagggtgtggtatttgtgttgaagta tgtccaaccaaccctaaatcactattgatgtttgaagagcgtatagataatgatgaagct ctggcacagtggcctgagaaagagtaa

DBGET integrated database retrieval system