Hypericibacter terrae: FRZ44_17060 Help Entry FRZ44_17060       CDS       T06396                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism htq  Hypericibacter terrae Pathway htq01100   Metabolic pathways htq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:htq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FRZ44_17060    00074 Mycolic acid biosynthesis     FRZ44_17060   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FRZ44_17060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEX16413 UniProt:  A0A5J6MG40 LinkDB All DBs Position 1838220..1838474 Genome browser AA seq 84 aa AA seqDB search MNRDEIKAALLQQIGNIAPEADLSKLDPAVDFREELDIDSIGFLNLVIALAEQLKIPIPE KDYARLRTIESALGYLTAARQRIT NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaaccgtgacgagatcaaggccgccctgcttcagcagatcggcaatatcgcgcccgaa gccgatttgtcgaagctcgatcctgctgtcgattttcgcgaggagctcgacatcgattcg atcggctttctcaaccttgtcattgcgctggcggagcagctgaagattccaattccggag aaggactatgcccgtcttcggacgatcgaaagcgccctcggctacctgacagcggcgagg cagcggatcacctga

DBGET integrated database retrieval system