Hypericibacter terrae: FRZ44_20570 Help Entry FRZ44_20570       CDS       T06396                                  Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism htq  Hypericibacter terrae Pathway htq00030   Pentose phosphate pathway htq00051   Fructose and mannose metabolism htq00710   Carbon fixation by Calvin cycle htq01100   Metabolic pathways htq01110   Biosynthesis of secondary metabolites htq01120   Microbial metabolism in diverse environments htq01200   Carbon metabolism htq01230   Biosynthesis of amino acids Module htq_M00004   Pentose phosphate pathway (Pentose phosphate cycle) htq_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:htq00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     FRZ44_20570    00051 Fructose and mannose metabolism     FRZ44_20570   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     FRZ44_20570 Enzymes [BR:htq01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      FRZ44_20570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  QEX16762 UniProt:  A0A5J6MGZ1 LinkDB All DBs Position 2218074..2218511 Genome browser AA seq 145 aa AA seqDB search MPQETIAIAADHAGFELKELLKAELAAGGYKPLDLGTAGPESVDYPDFADKLAAALKDGL ALRGVLICGTGIGISIAANRHRHIRAAVCHDGTSAKLARLHNNANVLALGARLLGPEVAK DCLAAFLATAFEGGERHNRRVGKLS NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgccgcaagagaccatcgccatcgctgccgaccatgcgggattcgagctgaaggaactg ctcaaggcggagctcgccgcgggcggatataagccgctcgatctcggcacggccggcccg gaatccgtggattatcccgatttcgccgacaagctggccgcggccctcaaggacggcctt gcgctccgcggcgtgctcatctgcggcaccgggatcggcatctcgatcgccgccaatcgc catcgccatatccgcgccgcggtctgccatgacggcaccagcgccaagctcgcccgcctc cacaacaacgccaatgtgctggccctgggcgctcgtctgctcgggcccgaggtcgccaag gactgcctggcggcgtttctcgccacggccttcgagggcggcgagcgacacaaccggcgc gtcggcaaattgtcctga

DBGET integrated database retrieval system