Hypericibacter terrae: FRZ44_39460 Help Entry FRZ44_39460       CDS       T06396                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism htq  Hypericibacter terrae Pathway htq03430   Mismatch repair Brite KEGG Orthology (KO) [BR:htq00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     FRZ44_39460  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:htq03400]     FRZ44_39460 Enzymes [BR:htq01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      FRZ44_39460 DNA repair and recombination proteins [BR:htq03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      FRZ44_39460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S TPR_7 Hydantoinase_B TACC_C Motif Other DBs NCBI-ProteinID:  QEX18638 UniProt:  A0A5J6MM95 LinkDB All DBs Position complement(4273175..4273426) Genome browser AA seq 83 aa AA seqDB search MAESKIPADVAKMSFEEALGELQALVRALEKGESKLDEAVQFYERGAALKRHCEAKLRDA QEKVAKIVIGADGSVGSEPVDLG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccgagtccaagatcccggcagacgtcgccaaaatgagtttcgaggaggcgctcggc gagttgcaggcgctggtgcgtgcgctcgaaaagggcgaaagcaagctcgacgaggcggtc cagttctacgaacgtggcgccgccttgaaacggcattgcgaggccaagcttcgcgatgcg caggagaaggtcgccaagatcgtcatcggcgccgacgggagcgtcggcagcgagcccgtg gatctgggctga

DBGET integrated database retrieval system