Hydrogenovibrio thermophilus: EPV75_04000 Help Entry EPV75_04000       CDS       T05808                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism htr  Hydrogenovibrio thermophilus Pathway htr01100   Metabolic pathways htr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:htr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EPV75_04000    00074 Mycolic acid biosynthesis     EPV75_04000   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EPV75_04000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  QAB14897 UniProt:  A0A410H1W4 LinkDB All DBs Position 867771..868007 Genome browser AA seq 78 aa AA seqDB search MSSIEERVKKIVVEQLGVEEDQVTPDASFIDDLGADSLDTVELVMALEEEFDCEIPDEEA EKISTLAQATAYVEANLD NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagtattgaagaacgcgtcaaaaaaattgttgtagaacaattgggtgttgaagaa gaccaggttacccctgatgcttctttcatcgatgatttaggtgcggattcattggacaca gttgagttggttatggcattggaagaagagtttgactgcgaaattcctgacgaagaagca gaaaaaatctctactttagcgcaagcaactgcttatgtagaagcgaacctagactga

DBGET integrated database retrieval system