Vreelandella titanicae: HZS52_18975 Help Entry HZS52_18975       CDS       T06950                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism htt  Vreelandella titanicae Pathway htt01100   Metabolic pathways htt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:htt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HZS52_18975 (acpP)    00074 Mycolic acid biosynthesis     HZS52_18975 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HZS52_18975 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  QNU61813 LinkDB All DBs Position complement(4105298..4105531) Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgttaagaaagttgtagcagagcgcctgaacgttaaagaa gaagacatccaaaacagctcttcttttacagaagacttgggtgctgattcgctcgacacc gttgagctggtcatggctttggaagaggaattcgatactgaaattcccgatgaagaagct gagaagatcaccacggttcaagaagccatcgattacgtgaacgcccaccagtaa

DBGET integrated database retrieval system