Vreelandella titanicae: HZS52_19515 Help Entry HZS52_19515       CDS       T06950                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism htt  Vreelandella titanicae Pathway htt02024   Quorum sensing htt03018   RNA degradation Brite KEGG Orthology (KO) [BR:htt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HZS52_19515 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HZS52_19515 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:htt03019]     HZS52_19515 (hfq)    03036 Chromosome and associated proteins [BR:htt03036]     HZS52_19515 (hfq) Messenger RNA biogenesis [BR:htt03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HZS52_19515 (hfq) Chromosome and associated proteins [BR:htt03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HZS52_19515 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QNU61916 LinkDB All DBs Position complement(4217654..4217902) Genome browser AA seq 82 aa AA seqDB search MSKGQSLQDPYLNILRKERIPVSIFLVNGIKLQGQIESFDQFVILLRNTVSQMVYKHAIS TVVPSRNVRLPAQDPAEQDAEI NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtccaaagggcagtcccttcaagacccgtacttgaacattctgcgcaaggagcgcatt ccggtctctatctttttggtcaacggcattaagctgcagggccagatcgaatcgtttgac cagtttgttatcctgctgcgcaataccgttagtcagatggtttataaacacgctatttcc acggttgttccatctcgcaacgtacgcttgcctgcgcaagacccggcagagcaggatgcg gagatttaa

DBGET integrated database retrieval system