Vreelandella titanicae: HZS52_24160 Help Entry HZS52_24160       CDS       T06950                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism htt  Vreelandella titanicae Pathway htt01100   Metabolic pathways htt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:htt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HZS52_24160    00074 Mycolic acid biosynthesis     HZS52_24160   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HZS52_24160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QNU62779 LinkDB All DBs Position 5257160..5257387 Genome browser AA seq 75 aa AA seqDB search MNEIKSILINMFEMEEDSISQNKTLEELGLDSISIVELQSGLEATLGLPSESLSLMPEMT LEDIEDSIERLKNDK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaatgagataaaatcaattttgatcaatatgtttgaaatggaagaagactccatttca caaaataaaactttggaggaactaggtttagattccatttctatcgtggagttacagtca gggctagaagcaactctaggacttccaagcgagtcgttatctttgatgccagaaatgaca ttagaggatattgaagattctatagagaggctaaaaaatgacaaataa

DBGET integrated database retrieval system