Haloterrigena turkmenica: Htur_3054 Help Entry Htur_3054         CDS       T01154                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism htu  Haloterrigena turkmenica Pathway htu03010   Ribosome Brite KEGG Orthology (KO) [BR:htu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Htur_3054   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Htur_3054  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:htu03011]     Htur_3054    04121 Ubiquitin system [BR:htu04121]     Htur_3054   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:htu04147]     Htur_3054 Ribosome [BR:htu03011]  Ribosomal proteins   Eukaryotes    Small subunit     Htur_3054   Archaea     Htur_3054 Ubiquitin system [BR:htu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Htur_3054 Exosome [BR:htu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Htur_3054   Exosomal proteins of colorectal cancer cells    Htur_3054 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Rcat_RNF216 Zn_Ribbon_TF Zn_ribbon_RPB9 Ribosomal_L37e zf-C2H2_FBX41 Cas12f1-like_TNB Zn_ribbon_3 DUF7575 HypA DUF5817 Motif Other DBs NCBI-ProteinID:  ADB61921 UniProt:  D2RYV3 LinkDB All DBs Position complement(3135300..3135434) Genome browser AA seq 44 aa AA seqDB search MPRHELYDDDGSTEREQCPRCGDSFLADHGDRQHCGKCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgccacgacacgaactctacgacgacgacggcagcaccgagcgcgaacagtgcccccgc tgcggggactccttcctcgccgaccacggtgaccgccagcactgcggcaagtgcgggtac accgagtgggaatag

DBGET integrated database retrieval system