Haloterrigena turkmenica: Htur_3158 Help Entry Htur_3158         CDS       T01154                                  Name (GenBank) Ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism htu  Haloterrigena turkmenica Pathway htu03010   Ribosome Brite KEGG Orthology (KO) [BR:htu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Htur_3158   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Htur_3158  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:htu03011]     Htur_3158    04121 Ubiquitin system [BR:htu04121]     Htur_3158 Ribosome [BR:htu03011]  Ribosomal proteins   Eukaryotes    Large subunit     Htur_3158   Archaea     Htur_3158 Ubiquitin system [BR:htu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Htur_3158 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR zf-CHY DUF7577 DZR_2 Zn_ribbon_3 Zn_ribbon_RPAB4 Ribosomal_L37e Motif Other DBs NCBI-ProteinID:  ADB62023 UniProt:  D2RZI4 LinkDB All DBs Position complement(3246866..3247015) Genome browser AA seq 49 aa AA seqDB search MPSFDAAEKRTLEKMICMRCNARNSPGADRCRKCGYKNLRPKAKEPRAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atgccaagtttcgacgccgccgagaaacggacgctcgagaagatgatctgcatgcgctgt aacgcccgcaactccccgggagctgaccgctgtcgcaagtgcggctacaagaacctccgc cccaaggcgaaggaaccccgcgcagcataa

DBGET integrated database retrieval system