KEGG   Billgrantia tianxiuensis: EKK97_21130
Entry
EKK97_21130       CDS       T08051                                 
Name
(GenBank) LysR family transcriptional regulator
  KO
K21757  LysR family transcriptional regulator, benzoate and cis,cis-muconate-responsive activator of ben and cat genes
Organism
htx  Billgrantia tianxiuensis
Brite
KEGG Orthology (KO) [BR:htx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:htx03000]
    EKK97_21130
Transcription factors [BR:htx03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    EKK97_21130
SSDB
Motif
Pfam: LysR_substrate HTH_1 SBP_bac_3
Other DBs
NCBI-ProteinID: QHC51602
UniProt: A0A6I6SP37
LinkDB
Position
4522449..4523351
AA seq 300 aa
MELRHLRYFCVVAEELNLTRAATRLHMAQPPLSRQIKQLEGEIGAELFERSARGLRLTPA
GQLFHEHTLQIMEKLDTTIAATQRLARSKRVMFGIGFVPSVFYGQLPLLVRELRQKDNVE
LVLAELTTVQQVQALKSGRIDMGFGRMRIDDPDVEQENLFDEPLMAALPEGHPLADTVPT
LAQLAEYPLVLFPAQPRPSLADMTLGLFRRRGLKVTVAQEANELQTALGLVASEIGITLV
PEQVKRVRRDGIVYVYLADPGLTSPVICSRRKGEAPSPIMQEANAILEVLVENRRSGRYP
NT seq 903 nt   +upstreamnt  +downstreamnt
atggagctgcgacatctgcgctacttctgcgtcgtggcggaggagctgaacctgacccgg
gcggccaccaggctgcacatggcacagccgccattgtcacgacaaatcaaacagttggag
ggagagatcggcgccgagttgttcgagcggagtgcgcgcgggctgcgcctgacgccggcg
ggccagctcttccatgagcataccctgcagataatggagaagctcgacaccaccatcgcc
gcgacccagcgcctggcccgcagcaagcgcgtgatgttcggcatcggcttcgttccttcg
gtgttctacggccagttgccgctgctggtacgtgaattacgacaaaaggataacgtcgag
ctggtgctggccgagctgaccacggtgcagcaggtgcaggcgctcaagagcgggcgcatc
gacatgggcttcggccgcatgcgcatcgacgaccccgacgtggaacaggagaacctgttc
gacgagccgctgatggccgccctgcccgaaggccatccgctggccgataccgtgccgacc
ctggcccagctcgccgagtatcccctggtgttgttcccggcccagccgcgccccagcctg
gccgacatgacgctggggctgtttcgccgccgtgggctcaaggtcaccgtggcgcaggag
gccaacgagctgcagaccgcgctcggcctggtggcctcggagatcggcatcaccctggtg
ccggagcaggtcaagcgggtcaggcgcgacggcatcgtctacgtctacctcgccgacccg
ggcctgacctcgccggtgatttgcagccggcgcaagggcgaggcgccctcgccgatcatg
caggaggccaatgccattctcgaggtgttggttgaaaaccgccgcagcggcaggtatccc
tga

DBGET integrated database retrieval system