Halorhabdus utahensis: Huta_1955 Help Entry Huta_1955         CDS       T00971                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hut  Halorhabdus utahensis Pathway hut03010   Ribosome Brite KEGG Orthology (KO) [BR:hut00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Huta_1955   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Huta_1955  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hut03011]     Huta_1955    04121 Ubiquitin system [BR:hut04121]     Huta_1955   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hut04147]     Huta_1955 Ribosome [BR:hut03011]  Ribosomal proteins   Eukaryotes    Small subunit     Huta_1955   Archaea     Huta_1955 Ubiquitin system [BR:hut04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Huta_1955 Exosome [BR:hut04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Huta_1955   Exosomal proteins of colorectal cancer cells    Huta_1955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_RPB9 zf-Tbcl_FmdE DZR_2 Zn_ribbon_19 Motif Other DBs NCBI-ProteinID:  ACV12123 UniProt:  C7NT48 LinkDB All DBs Position complement(1979755..1979889) Genome browser AA seq 44 aa AA seqDB search MARHELYNDDGTTDRELCPRCGDAFLAQHGDRTHCGRCSYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgtcacgagctctacaacgacgacggaaccaccgaccgtgaactgtgcccgcgg tgtggcgacgcgttccttgcccagcacggtgaccgcacgcactgcggccggtgtagctac accgagtgggagtaa

DBGET integrated database retrieval system