KEGG   Hymenobacter volaticus: MUN86_15405
Entry
MUN86_15405       CDS       T09412                                 
Name
(GenBank) YggS family pyridoxal phosphate-dependent enzyme
  KO
K06997  PLP dependent protein
Organism
hvl  Hymenobacter volaticus
Brite
KEGG Orthology (KO) [BR:hvl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    MUN86_15405
SSDB
Motif
Pfam: Ala_racemase_N
Other DBs
NCBI-ProteinID: UOQ64944
UniProt: A0ABY4G2Y8
LinkDB
Position
3571433..3572101
AA seq 222 aa
MSISSQIQFFESQLAGTNCRLVTVTKTHPVERLQEAYDAGARLFGENKVQEMAAKQPELP
ADIEWHLIGHLQTNKVKYIAPFVHTIQSVDSLKLLLEMEKQAAKHNRVINGLLQFHIAAE
ETKTGLTLAEAEEILQSEAYKSLQHVRLTGVMAIATNTPDETQLRREFSELSGYFELLKS
RYFTGNEAFREISMGMSSDYQLAIAEGSTLIRVGSAIFGSRN
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtccatatccagccaaattcagttcttcgaaagtcaattagcaggcaccaactgccgc
ctagtcaccgtcacgaaaacgcacccagtggagcgcttgcaagaagcctacgacgctggc
gcgcggctttttggggaaaacaaagttcaggaaatggccgctaagcagcccgagttgcct
gccgatatcgagtggcacctcattgggcatttgcaaactaacaaggtcaaatacatagct
ccgttcgtgcacaccatccagagcgtggacagcttaaaactgctgctggagatggaaaag
caggcagccaagcacaaccgcgtcatcaacgggctacttcagtttcatattgctgcggag
gaaaccaaaacgggcctcacccttgcggaagcagaggaaatcttgcaatccgaagcatac
aaaagtttgcagcacgtccgcctgaccggggttatggccattgctaccaacactcctgac
gaaactcagctacgtcgggagttcagcgagttgagcggttacttcgaactactgaaatct
cgctacttcactggcaatgaggcgttccgagaaatatcgatgggcatgagttccgattac
cagttggctattgccgaaggcagcacgctcatccgcgtaggcagcgctatttttggcagc
agaaactaa

DBGET integrated database retrieval system