Haloquadratum walsbyi DSM 16790: HQ_1324A Help Entry HQ_1324A          CDS       T00375                                  Symbol rpl40e Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hwa  Haloquadratum walsbyi DSM 16790 Pathway hwa03010   Ribosome Brite KEGG Orthology (KO) [BR:hwa00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HQ_1324A (rpl40e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HQ_1324A (rpl40e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hwa03011]     HQ_1324A (rpl40e)    04121 Ubiquitin system [BR:hwa04121]     HQ_1324A (rpl40e) Ribosome [BR:hwa03011]  Ribosomal proteins   Eukaryotes    Large subunit     HQ_1324A (rpl40e)   Archaea     HQ_1324A (rpl40e) Ubiquitin system [BR:hwa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HQ_1324A (rpl40e) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 DHHC SelP_N Zn_ribbon_RPAB4 HypA Zn_ribbon_RanBP Motif Other DBs NCBI-ProteinID:  CAJ51453 UniProt:  Q18KJ5 LinkDB All DBs Position 417121..417270 Genome browser AA seq 49 aa AA seqDB search MARNEAAIKRTLEKQICMRCNARNPQRASECRKCGYSNLRPKSKERRAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcaaggaatgaagctgcaataaaacgaacgctcgaaaagcaaatttgtatgcgctgt aatgcacggaatccacaacgtgcgagtgaatgtcgtaaatgtgggtatagcaatctccgt ccaaagtcaaaagaacgaagagctgcgtaa

DBGET integrated database retrieval system