KEGG   Haloquadratum walsbyi DSM 16790: HQ_2597A
Entry
HQ_2597A          CDS       T00375                                 
Symbol
phnC2
Name
(GenBank) ABC-type transport system ATP-binding protein (probable substrate phosphate/phosphonate)
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
hwa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hwa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HQ_2597A (phnC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hwa02000]
    HQ_2597A (phnC2)
Enzymes [BR:hwa01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     HQ_2597A (phnC2)
Transporters [BR:hwa02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    HQ_2597A (phnC2)
SSDB
Motif
Pfam: ABC_tran SMC_N RsgA_GTPase AAA_21 AAA_16 AAA_23 AAA_29 AAA_22 Oxidored_FMN nSTAND1 nSTAND3 Zeta_toxin AAA_27 Ppx-GppA_III
Other DBs
NCBI-ProteinID: CAJ52709
UniProt: Q18H36
LinkDB
Position
complement(1870894..1871739)
AA seq 281 aa
MSTLTVDNVTKTYGDVVALDSVSFEIENEFVVLLGESGAGKSTMLRCVNGLTHPTEGEIR
LNGDPINGSRSDIGMIFQQHNLVDGVSAYMNALTGSLDRTSTVSSLLQQQNKETKERALE
ALQTVGLLEESHQRTSQMSGGQQQRVGIARALVQDPALLLADEPVASLDPSSAESVMDYL
KKAASVHEVTALVSLHQVNIAAYFGERFIGLRDGEILFDVSPEKLTPGLVDDLYGNVETV
GLATDNSDNSTVDTSDGTRYDTETGSDGTDEVDVIGRQVES
NT seq 846 nt   +upstreamnt  +downstreamnt
atgagcacacttactgtagataacgtaacaaaaacatatggtgacgtcgttgcactcgat
tcagtctcattcgagattgaaaatgaatttgttgtccttctcggtgaatcaggagctgga
aagtcaacgatgctccgctgtgttaacggactaacacatccaaccgaaggagagattcgg
cttaatggggatccaatcaatggctcacgctctgacattgggatgatattccagcaacac
aatctcgttgatggtgtttcagcgtatatgaatgcacttactggttcacttgatcgaacg
tcgacagttagcagtctattacaacagcaaaataaagagacaaaagaacgcgcgcttgaa
gcacttcagaccgttgggcttcttgaggagtcacatcagcgtacctcacagatgagtggt
gggcaacaacagcgtgttggaattgcacgagcacttgtacaggatccagcattacttctt
gcggacgaacctgttgcaagcctcgatccctcaagtgcagagagtgtaatggactatctc
aaaaaagcagcaagcgttcatgaagttactgcactcgtcagtcttcatcaagtaaatatt
gcagcttactttggtgaacgatttattggactccgcgatggtgagatactctttgacgtc
agtcctgagaaacttaccccaggtctcgttgacgatctctatggaaatgtcgagacggtt
gggcttgcaactgataatagcgataactcaactgtagatacttctgatggtactcgttac
gacaccgaaaccggtagtgatggtactgatgaggtagatgttattgggcggcaagtagaa
tcatga

DBGET integrated database retrieval system