Haloquadratum walsbyi C23: Hqrw_1359 Help Entry Hqrw_1359         CDS       T01942                                  Symbol rpl40e Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hwc  Haloquadratum walsbyi C23 Pathway hwc03010   Ribosome Brite KEGG Orthology (KO) [BR:hwc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Hqrw_1359 (rpl40e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Hqrw_1359 (rpl40e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hwc03011]     Hqrw_1359 (rpl40e)    04121 Ubiquitin system [BR:hwc04121]     Hqrw_1359 (rpl40e) Ribosome [BR:hwc03011]  Ribosomal proteins   Eukaryotes    Large subunit     Hqrw_1359 (rpl40e)   Archaea     Hqrw_1359 (rpl40e) Ubiquitin system [BR:hwc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Hqrw_1359 (rpl40e) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 DHHC HVO_0416 SelP_N Zn_ribbon_RPAB4 Motif Other DBs NCBI-ProteinID:  CCC39315 UniProt:  G0LHS7 LinkDB All DBs Position 387963..388112 Genome browser AA seq 49 aa AA seqDB search MARNEAAIKRTLEKQICMRCNARNPQRASECRKCGYSNLRPKSKERRAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcaaggaatgaagctgcaataaaacgaacgctcgaaaagcaaatttgtatgcgctgt aatgcacggaatccacaacgtgcgagtgaatgtcgtaaatgtgggtatagcaatctccgt ccaaagtcaaaagaacgaagagctgcgtaa

DBGET integrated database retrieval system