Helicobacter winghamensis: A0Z60_03540 Help Entry A0Z60_03540       CDS       T07030                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism hwi  Helicobacter winghamensis Pathway hwi00020   Citrate cycle (TCA cycle) hwi00720   Other carbon fixation pathways hwi01100   Metabolic pathways hwi01110   Biosynthesis of secondary metabolites hwi01120   Microbial metabolism in diverse environments hwi01200   Carbon metabolism hwi01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:hwi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     A0Z60_03540   09102 Energy metabolism    00720 Other carbon fixation pathways     A0Z60_03540 Enzymes [BR:hwi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      A0Z60_03540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_21 Fer4_2 Fer4_9 Fer4_6 Fer4_16 Fer4_8 Fer4_13 Fer4_4 Fer4_17 Fer4_15 Fer4_3 SAM_Ste50p A-ATP_synth_H_N Motif Other DBs NCBI-ProteinID:  QOQ98648 LinkDB All DBs Position complement(706790..707101) Genome browser AA seq 103 aa AA seqDB search MGLLKAPDNTPVWVNENRCKACDLCVSVCPSGTLAMRLDENRVLGKMVEIIHPESCIGCQ DCELHCPDFAISVADRKEFKFAKITDEAKQRAEAIKANHYMAV NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgggattattaaaagcccctgataatacacctgtttgggtgaatgagaatcgctgtaaa gcttgtgatttatgtgtatccgtatgtccttcagggacattggcaatgcgtcttgatgaa aatagagtcttgggaaaaatggtagagattattcatcctgaaagttgcattggttgtcaa gattgtgagttgcattgtccagattttgcaatttcagttgcagatagaaaagagtttaag tttgcaaagattactgatgaagcaaaacaaagagcagaagcaattaaagctaatcactat atggcagtataa

DBGET integrated database retrieval system