Helicobacter winghamensis: A0Z60_05935 Help Entry A0Z60_05935       CDS       T07030                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hwi  Helicobacter winghamensis Pathway hwi00998   Biosynthesis of various antibiotics hwi01100   Metabolic pathways hwi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hwi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A0Z60_05935 (acpP)    00074 Mycolic acid biosynthesis     A0Z60_05935 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A0Z60_05935 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QOQ97594 LinkDB All DBs Position 1180613..1180846 Genome browser AA seq 77 aa AA seqDB search MAIFDDVKAVVVEQLNVNEGEVKPESKFVDDLGADSLDVVELVMALEEKFEIEIPDEEAE KIQTVGDVVAYIEKAKA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaatatttgatgatgtaaaggcagttgttgtagaacaacttaatgtaaatgaaggt gaagtgaagccggaatctaagtttgtagatgatttgggcgcggattctttagatgttgtt gaacttgtaatggcattagaagaaaaatttgaaattgaaatcccagatgaagaagctgaa aaaatccaaacagttggcgatgttgttgcctacattgaaaaggcaaaagcttaa

DBGET integrated database retrieval system