Hwangdonia lutea: RNZ46_06340 Help Entry RNZ46_06340       CDS       T09455                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism hws  Hwangdonia lutea Brite KEGG Orthology (KO) [BR:hws00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hws03032]     RNZ46_06340    03036 Chromosome and associated proteins [BR:hws03036]     RNZ46_06340    03400 DNA repair and recombination proteins [BR:hws03400]     RNZ46_06340 DNA replication proteins [BR:hws03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RNZ46_06340 Chromosome and associated proteins [BR:hws03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RNZ46_06340 DNA repair and recombination proteins [BR:hws03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RNZ46_06340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  WOD44882 UniProt:  A0AA97HRQ4 LinkDB All DBs Position 1463373..1463663 Genome browser AA seq 96 aa AA seqDB search MTKADLVAKISEKLGIEKGDVQATVETFMEEVKTSLESGDNVYLRGFGSFIVKTRAEKTG RNISKNTTIKIPAHNIPAFKPAKVFVEGVKTNVEVK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgacgaaggctgatttagtagcaaagatttctgagaaattaggaattgaaaaaggtgat gttcaagcaactgttgaaacatttatggaagaagtaaaaacctctttggaaagtggtgac aatgtttatttaagaggttttggaagctttattgtaaaaacaagagctgaaaagactgga agaaatatctctaaaaatacaaccattaaaataccggctcataacattcctgcatttaag cctgcaaaagtttttgtagaaggcgttaaaacaaatgtagaagtgaagtaa

DBGET integrated database retrieval system