Halopiger xanaduensis: Halxa_2094 Help Entry Halxa_2094        CDS       T01532                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hxa  Halopiger xanaduensis Pathway hxa03010   Ribosome Brite KEGG Orthology (KO) [BR:hxa00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Halxa_2094   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Halxa_2094  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hxa03011]     Halxa_2094    04121 Ubiquitin system [BR:hxa04121]     Halxa_2094   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hxa04147]     Halxa_2094 Ribosome [BR:hxa03011]  Ribosomal proteins   Eukaryotes    Small subunit     Halxa_2094   Archaea     Halxa_2094 Ubiquitin system [BR:hxa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Halxa_2094 Exosome [BR:hxa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Halxa_2094   Exosomal proteins of colorectal cancer cells    Halxa_2094 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Rcat_RNF216 Zn_ribbon_RPB9 FYVE zf-C2H2_FBX41 Zn_Ribbon_TF Motif Other DBs NCBI-ProteinID:  AEH36719 UniProt:  F8D7Y4 LinkDB All DBs Position 1418873..1419007 Genome browser AA seq 44 aa AA seqDB search MARHELYNDDGSTDREQCPRCGDSFLADHGDRKHCGKCSYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcacgccacgaactctacaacgacgacggcagcaccgaccgcgagcagtgcccccga tgcggcgactccttcctcgccgaccacggcgaccgcaagcactgcggcaagtgcagctac accgagtgggagtaa

DBGET integrated database retrieval system