Halosquirtibacter xylanolyticus: K5X82_01050 Help Entry K5X82_01050       CDS       T10547                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism hxy  Halosquirtibacter xylanolyticus Pathway hxy00020   Citrate cycle (TCA cycle) hxy00720   Other carbon fixation pathways hxy01100   Metabolic pathways hxy01110   Biosynthesis of secondary metabolites hxy01120   Microbial metabolism in diverse environments hxy01200   Carbon metabolism hxy01210   2-Oxocarboxylic acid metabolism Module hxy_M00009   Citrate cycle (TCA cycle, Krebs cycle) hxy_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:hxy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     K5X82_01050   09102 Energy metabolism    00720 Other carbon fixation pathways     K5X82_01050 Enzymes [BR:hxy01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      K5X82_01050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_6 Fer4_2 Fer4_10 Fer4_9 Fer4_16 Fer4_4 LdpA_Fe-S-bd Fer4_15 Fer4_3 Fer4_13 Fer4_17 Fer4_8 Fer4_18 Motif Other DBs NCBI-ProteinID:  QZT37494 LinkDB All DBs Position complement(314297..314524) Genome browser AA seq 75 aa AA seqDB search MAKIKGAVVVDREECKGCNLCVVACPTQTLSLNRNVNGKGYNFSYMENPDSCIGCSNCSL VCPDSCITVYRVKTA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctaaaataaaaggagctgtagtggtggatcgagaagaatgcaaagggtgtaacctt tgtgttgtagcttgtccgacacaaacactaagcctaaaccgcaacgtcaatggcaagggc tacaatttctcctatatggagaatccagatagttgcataggatgttccaactgttcgttg gtatgtccagatagttgtattacagtgtaccgagtaaaaactgcttaa

DBGET integrated database retrieval system