Hydrogenophaga sp. PBC: Q5W_13185 Help Entry Q5W_13185         CDS       T04491                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism hyb  Hydrogenophaga sp. PBC Brite KEGG Orthology (KO) [BR:hyb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hyb03032]     Q5W_13185    03036 Chromosome and associated proteins [BR:hyb03036]     Q5W_13185    03400 DNA repair and recombination proteins [BR:hyb03400]     Q5W_13185 DNA replication proteins [BR:hyb03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Q5W_13185 Chromosome and associated proteins [BR:hyb03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     Q5W_13185 DNA repair and recombination proteins [BR:hyb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       Q5W_13185 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 ALF HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AOS79849 LinkDB All DBs Position complement(2784240..2784512) Genome browser AA seq 90 aa AA seqDB search MNKTELVEHIAKHADISKAAATRALDSTIAAIRTTLKKGGTVSLVGFGSFAVSKRPARKG RNPRTGAEIKIKAAKVPKFRPGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagaccgaactcgtcgaacacatcgccaagcacgccgacatctccaaggccgcc gcgacacgtgcactcgactccaccatcgccgccatccgcaccacgctcaagaagggcggc accgtttccctggtgggcttcggctcgttcgccgtgagcaagcgccccgcccgcaagggc cgcaacccgcgcacgggcgccgagattaaaatcaaggccgccaaagtgccgaagttccgc cccggcaaggcactgaaggacgcggtcaactga

DBGET integrated database retrieval system