Hymenobacter sp. DG25B: PK28_05565 Help Entry PK28_05565        CDS       T03500                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hyd  Hymenobacter sp. DG25B Pathway hyd01100   Metabolic pathways hyd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hyd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PK28_05565    00074 Mycolic acid biosynthesis     PK28_05565   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PK28_05565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AIZ63295 LinkDB All DBs Position 1290895..1291131 Genome browser AA seq 78 aa AA seqDB search MSEIAEKVKAIIIDKLGVEASEVTPEASFTNDLGADSLDTVELIMEFEKEFNVSIPDDQA ENIGTVGQAISYLEQHAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgaaattgcagaaaaagtaaaggccatcatcatcgataaactcggcgtagaagct tcggaagtaactccggaggccagcttcaccaacgacctgggtgctgactcgctggatact gttgagctgatcatggaatttgaaaaagaattcaacgtatcgattcccgacgaccaggcc gaaaacatcggtaccgtgggtcaggctatcagctacctcgagcagcacgctaagtag

DBGET integrated database retrieval system