Ephemeroptericola cinctiostellae: DTO96_101468 Help Entry DTO96_101468      CDS       T05560                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism hyf  Ephemeroptericola cinctiostellae Pathway hyf01100   Metabolic pathways hyf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hyf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DTO96_101468 (acpP)    00074 Mycolic acid biosynthesis     DTO96_101468 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DTO96_101468 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AXF85734 UniProt:  A0A345DBJ6 LinkDB All DBs Position 1612838..1613077 Genome browser AA seq 79 aa AA seqDB search MENIEQRVRKIVAEQLGVNEADIKNESSFTNDLGADSLDTVELVMALEDEFECEIPDEDA EKITTVQQAIDYVSANVGK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaaacattgaacaacgcgtccgtaaaattgttgcagagcaattgggtgtgaatgaa gccgacatcaaaaacgaatcatctttcactaacgacttgggtgcagactctttggataca gtggaattggttatggctttggaagacgaatttgaatgcgaaatccctgatgaagacgca gaaaaaatcaccacagttcaacaagcaattgattacgtgtcggcaaatgtcggtaaataa

DBGET integrated database retrieval system