Hydrogenophaga crassostreae: LPB072_14100 Help Entry LPB072_14100      CDS       T04505                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism hyl  Hydrogenophaga crassostreae Brite KEGG Orthology (KO) [BR:hyl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hyl03032]     LPB072_14100    03036 Chromosome and associated proteins [BR:hyl03036]     LPB072_14100    03400 DNA repair and recombination proteins [BR:hyl03400]     LPB072_14100 DNA replication proteins [BR:hyl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LPB072_14100 Chromosome and associated proteins [BR:hyl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LPB072_14100 DNA repair and recombination proteins [BR:hyl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LPB072_14100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 ALF HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AOW13803 UniProt:  A0A162Z810 LinkDB All DBs Position complement(3067246..3067518) Genome browser AA seq 90 aa AA seqDB search MNKTELVEHIAKNADISKAAAARALDSTITAIRTTLKKGGTVSLVGFGSFAVTKRPARKG RNPRTGEEIKIKAAKVPKFRPGKALKDALN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagaccgaactcgttgagcacattgctaaaaacgctgacatttccaaggcggct gcagcgcgtgcactggactccaccatcaccgccattcgcacgaccttgaaaaaaggcggc actgtttccttggtcggttttggttcgtttgctgtgaccaagcgcccagctcgcaagggt cgcaacccccgcaccggcgaagagattaaaatcaaggcagccaaggtgcccaagttccgt ccaggcaaggctttgaaagacgcgctcaactga

DBGET integrated database retrieval system