Hydrogenophaga crassostreae: LPB072_18145 Help Entry LPB072_18145      CDS       T04505                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism hyl  Hydrogenophaga crassostreae Pathway hyl00361   Chlorocyclohexane and chlorobenzene degradation hyl00362   Benzoate degradation hyl00623   Toluene degradation hyl01100   Metabolic pathways hyl01120   Microbial metabolism in diverse environments hyl01220   Degradation of aromatic compounds Module hyl_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:hyl00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     LPB072_18145    00361 Chlorocyclohexane and chlorobenzene degradation     LPB072_18145    00623 Toluene degradation     LPB072_18145 Enzymes [BR:hyl01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      LPB072_18145     1.14.13.244  phenol 2-monooxygenase (NADH)      LPB072_18145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  AOW14468 UniProt:  A0A162PBJ2 LinkDB All DBs Position 3934425..3934781 Genome browser AA seq 118 aa AA seqDB search MSVVALKPYDFPMKDVRENFPAPLLYIGWEEHLMFCAPFCLPLPPDTPFGALATAVLPGI FGYHPDFARIDWDQVEWKKNGQPWKPDSAKSLADNGLTHKDAIRFRTPGLTGIKGSFS NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgagcgttgttgccctcaagccctacgactttccaatgaaggacgtgcgcgaaaacttt cccgcgccgctgctctacatcggctgggaagagcacctgatgttctgtgctccgttctgc ctgccgctgccacccgacacaccatttggtgcgctggccacagcggtgctgccgggcatc ttcggttaccaccctgacttcgccaggatcgactgggaccaggtcgagtggaagaaaaac gggcagccctggaagcccgactccgcgaaatcactggccgacaacggcctgacgcacaag gatgcgatccgtttccgcacgccgggcctgacggggatcaaaggcagcttcagctga

DBGET integrated database retrieval system