Hymenobacter sp. APR13: N008_03350 Help Entry N008_03350        CDS       T03213                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism hym  Hymenobacter sp. APR13 Pathway hym03430   Mismatch repair Brite KEGG Orthology (KO) [BR:hym00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     N008_03350  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:hym03400]     N008_03350 Enzymes [BR:hym01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      N008_03350 DNA repair and recombination proteins [BR:hym03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      N008_03350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S DprA_WH CHASE3 DUF4088 NPV_P10 Motif Other DBs NCBI-ProteinID:  AII51019 UniProt:  A0A076HTY1 LinkDB All DBs Position 783572..783859 Genome browser AA seq 95 aa AA seqDB search METTYRDAIAELETILRALETDTVDVDELTARVQRSATLIRLCKQKLRTAEDAIDRVFEN LDQDEELPEPEAPAPTPPAKRTPKTPRDTSGGLLF NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggaaaccacctaccgcgacgctatagctgaactggaaaccattctgcgggctctggaa accgatactgtagatgtagacgagctgacggcccgcgtgcagcgctcggccacgctcatc cgcctctgcaaacagaagttgcgcaccgccgaagacgccatcgaccgggtgtttgagaac ctcgatcaggacgaggaactgcccgagcctgaagctcccgcccctacgccacccgccaaa cgcacgcccaaaaccccgcgcgacaccagcggtggtctgctgttttag

DBGET integrated database retrieval system