Hydrogenophaga sp. BPS33: F9K07_08465 Help Entry F9K07_08465       CDS       T06379                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism hyn  Hydrogenophaga sp. BPS33 Brite KEGG Orthology (KO) [BR:hyn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hyn03036]     F9K07_08465    03400 DNA repair and recombination proteins [BR:hyn03400]     F9K07_08465 Chromosome and associated proteins [BR:hyn03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     F9K07_08465 DNA repair and recombination proteins [BR:hyn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       F9K07_08465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Cdh1_DBD_1 Histone_HNS_N tRNA-synt_1b DUF1451 Motif Other DBs NCBI-ProteinID:  QHE84916 UniProt:  A0A6P1IVI0 LinkDB All DBs Position 1790997..1791302 Genome browser AA seq 101 aa AA seqDB search MASYSELMEQAQKLMAQAEQARKDELSAVIADIKAKMKQFGITAADLGSSTGGKKVGKSK SNAAAKYRGPNGELWAGGPGRKPEWVRSVLASGKSLDDYLI NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcaagttattccgagctgatggaacaggcccagaagctgatggcgcaggccgagcag gcgcgcaaagacgaactctccgccgtgattgccgacatcaaagccaagatgaagcaattc ggcattactgccgccgatctcggcagcagcacgggtggcaagaaggtcggcaaatcgaaa tccaatgccgccgccaagtaccgcggccccaatggcgaactctgggccggtggccctggc cgcaaacccgaatgggtgcgctccgtgctggcctcgggcaagagtctggacgactacctg atctga

DBGET integrated database retrieval system