Hydrogenophaga sp. BPS33: F9K07_08660 Help Entry F9K07_08660       CDS       T06379                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hyn  Hydrogenophaga sp. BPS33 Pathway hyn01100   Metabolic pathways hyn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hyn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F9K07_08660    00074 Mycolic acid biosynthesis     F9K07_08660   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F9K07_08660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF6218 Motif Other DBs NCBI-ProteinID:  QHE84951 UniProt:  A0A6P1IWE9 LinkDB All DBs Position complement(1830809..1831078) Genome browser AA seq 89 aa AA seqDB search MSEKTQTPISESDALGMLAECFNMPVDALHADLERDAIDDWDSMGALMLMAELDERFGLE LTAEVSREMTRIGDVLAFLRVHGVLFESS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagtgaaaaaacacagaccccgatctccgagagcgacgccttgggcatgctggccgag tgcttcaacatgccggtggacgctctgcacgcggacctggagcgcgacgccatcgacgac tgggactccatgggagcgctcatgctgatggccgagctcgacgagcgcttcggcctggaa ctgaccgccgaggtgtcgcgcgagatgacccgcatcggcgacgtgctggccttcctgcgg gtgcatggggtgctgtttgaaagcagttga

DBGET integrated database retrieval system