Hydrogenophaga sp. BPS33: F9K07_09515 Help Entry F9K07_09515       CDS       T06379                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hyn  Hydrogenophaga sp. BPS33 Pathway hyn01100   Metabolic pathways hyn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hyn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F9K07_09515 (acpP)    00074 Mycolic acid biosynthesis     F9K07_09515 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F9K07_09515 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF5785 Motif Other DBs NCBI-ProteinID:  QHE85105 UniProt:  A0A6P1IT51 LinkDB All DBs Position 2017320..2017559 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEEGQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEEA EKITTVQKAIDYAMANQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtgaagaaaatcattgccgaacaactcggtgtggaagag gggcaggtcacgaacgaaaaggcctttgtggccgacttgggcgccgattccctggacacg gttgagctggtgatggctctcgaagacgagttcggtatcgagatccccgacgaagaagcc gagaagatcaccacggttcaaaaagccatcgactacgcgatggccaaccagaaggcctga

DBGET integrated database retrieval system