KEGG   Hydrogenophaga sp. BPS33: F9K07_28805
Entry
F9K07_28805       CDS       T06379                                 
Name
(GenBank) pyridoxal-phosphate dependent enzyme
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hyn  Hydrogenophaga sp. BPS33
Pathway
hyn00260  Glycine, serine and threonine metabolism
hyn00750  Vitamin B6 metabolism
hyn01100  Metabolic pathways
hyn01110  Biosynthesis of secondary metabolites
hyn01120  Microbial metabolism in diverse environments
hyn01230  Biosynthesis of amino acids
Module
hyn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hyn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    F9K07_28805
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    F9K07_28805
Enzymes [BR:hyn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     F9K07_28805
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-ProteinID: QHE89086
LinkDB
Position
complement(6211884..6212966)
AA seq 360 aa
MLPVPTDQAVTLGEGGTPLHLARRMGELLGLKRLYIKDESCNPTHSYKDRLSAVAVSHAR
AQGASVVATASSGNAGASLAAYAARAGLQCVVASMKGASGPMMAQIRKYGAHLVMMDDKS
LRWPLLAEGAARHGWYVTSPHAAPVVGSTAVGIEGYKTIAYEIVGDLGSAPDWVVMPVCY
GDALAGIAQGFEDLLCAGEIDKRPRLVAAEAHGSLVNAMAHQTDCVDAVDAEYATLAASV
GANQSTYQALHWLRMSDGLAVQIGNEGLIDMQELVACREGLLYELASVMPFVAARQLARS
GVMREDDTVVCLATASGLKDTDKSTGSWNPLPVVTVGREQIPELASATHNLLSQRGGSVR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgctgcctgtgcccaccgatcaggcggtcacgctgggcgagggtggcacgccactgcac
cttgcacgccggatgggcgagctcctggggttgaagaggctgtatatcaaggacgagtcg
tgcaatccgacgcactcctacaaagaccggctcagcgcagtggccgtatcgcacgcccgg
gctcaaggggcgtccgtcgtcgcgaccgcttcgtcagggaatgccggagcgtcgctggcg
gcttacgctgcaagagccgggttgcagtgcgtggtggcctccatgaaaggcgcctccggt
cccatgatggcgcagatccgcaagtacggcgcgcacctcgtcatgatggacgacaagagc
ttgcgctggccgttgctggccgaaggcgctgctcgccacggctggtacgtcacgtctccg
catgccgcgccggtggtgggcagcacggcggtgggcatcgaaggctacaagaccattgcc
tatgagatcgtcggtgacttgggcagtgccccggactgggtcgtgatgcccgtctgctat
ggcgacgccctcgccggtatcgcgcagggtttcgaggacttgctatgcgctggtgagatc
gacaagcgcccccggctggtggcggccgaggcccatggctcgctcgtcaacgccatggcc
catcagaccgactgcgtggacgcggtggatgcagagtacgccacgctggccgcgtcggtc
ggtgcaaaccagagtacctaccaggcccttcactggttgcgtatgagcgatggtctggcc
gtgcagatcggcaatgaaggcctcatcgatatgcaggagctggtggcatgccgcgagggc
ttgctgtacgaactggccagtgtcatgccctttgtcgcagcgcggcagctcgcgcgcagc
ggtgtgatgcgggaggacgatacggtcgtttgcctggcgaccgcctctggcctcaaggac
accgacaagtcaacggggagctggaatccgctgcccgtcgtcaccgtgggccgggagcag
atcccggagctcgcgagcgccacccacaacctgttgtcgcagcgtggtggttcggtgcgc
tag

DBGET integrated database retrieval system