KEGG   Hymenobacter psoromatis: A0257_16610
Entry
A0257_16610       CDS       T04376                                 
Name
(GenBank) molybdenum ABC transporter permease subunit
  KO
K02018  molybdate transport system permease protein
Organism
hyp  Hymenobacter psoromatis
Pathway
hyp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hyp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A0257_16610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hyp02000]
    A0257_16610
Transporters [BR:hyp02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Molybdate transporter
    A0257_16610
SSDB
Motif
Pfam: BPD_transp_1 CydS
Other DBs
NCBI-ProteinID: AMR28554
LinkDB
Position
3866122..3866796
AA seq 224 aa
MPSDYWQTLRLTLALAACTTVLLLGLGLPLAYGLARSRSRLKPLLEAVVSLPLVLPPTVI
GFYLLLAFSDDTGVGRFLINRLGLSLNFTFAGILMGSLVYSLPFMVQPLQAGFQQLPRAL
AEAAATLGKSRFTTLWRVLLPNMRPALLSGAVLTFAHTLGEFGVVLLIGGNLPGRTRVAS
IAIYDEVESQHYGQANAYALTLVVVAFSILAALYWFSRRDARPS
NT seq 675 nt   +upstreamnt  +downstreamnt
ttgccttccgactactggcaaaccttgcgcctgacgctggcactggcggcctgcaccacg
gtgctgctgctggggctgggcctgccgctggcctacgggctggcgcgcagccgctcgcgc
ctcaagccgctgctggaagcggtggtgagcctgccgctggtgctgccgcccacagtcatt
ggattttacttgctgctggcgttcagcgacgacacgggggtagggcggtttttgattaac
cggctggggctgagtttgaacttcacgtttgccggcattttgatggggtcactggtatat
agcttgccttttatggtgcagccgttgcaggcggggtttcagcagctgccgcgcgcgctg
gccgaggcggcggccacgctgggcaaatcgcgctttacgaccctttggcgggtgctgctg
cccaatatgcgacccgcgctgctcagcggcgcggtgctcacttttgcccacacgctgggc
gaatttggggtggtgctgctgattggcggcaacctgccaggccgcacgcgcgtggcttcc
atcgctatttatgatgaggtcgagagccagcactacggccaggccaacgcctatgcgctc
acgctggtagtggtagctttcagcattctggcggcgctctactggtttagccggcgggac
gcccgcccgtcgtaa

DBGET integrated database retrieval system