Hydrogenophaga sp. RAC07: BSY239_1540 Help Entry BSY239_1540       CDS       T04455                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism hyr  Hydrogenophaga sp. RAC07 Pathway hyr01100   Metabolic pathways hyr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hyr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSY239_1540    00074 Mycolic acid biosynthesis     BSY239_1540   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSY239_1540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOF88051 UniProt:  A0A1B3M4P9 LinkDB All DBs Position complement(1625283..1625543) Genome browser AA seq 86 aa AA seqDB search MNVTDQVLRVLDQALSLQGRALGFDRSTPLLGDLPELDSMAVLALITGLEDHFGIAFEDD ELNGAVFATVGSLTDLVEQHLSSTGA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgtcaccgaccaagtcctgcgcgtgctcgaccaagccctcagcctgcagggccgc gccctcggcttcgaccgcagcacacccctgctcggcgacctgcccgagctcgactccatg gccgtgctcgcgctcatcaccgggcttgaggatcacttcggtatcgcctttgaagacgac gaactcaacggcgccgtgttcgccaccgtcggcagcctcaccgatctggtcgaacaacac ctgagcagcaccggcgcatga

DBGET integrated database retrieval system