Hydrogenophaga sp. RAC07: BSY239_1903 Help Entry BSY239_1903       CDS       T04455                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism hyr  Hydrogenophaga sp. RAC07 Pathway hyr02024   Quorum sensing hyr03018   RNA degradation Brite KEGG Orthology (KO) [BR:hyr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BSY239_1903 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BSY239_1903 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hyr03019]     BSY239_1903 (hfq)    03036 Chromosome and associated proteins [BR:hyr03036]     BSY239_1903 (hfq) Messenger RNA biogenesis [BR:hyr03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BSY239_1903 (hfq) Chromosome and associated proteins [BR:hyr03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BSY239_1903 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AOF87585 LinkDB All DBs Position complement(2011191..2011442) Genome browser AA seq 83 aa AA seqDB search MSNNKGQLLQDPFLNQLRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHA ISTIVPGRPVQFSAAPADESAAP NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgagcaataacaaaggccaactcttgcaagacccctttctgaaccagctgcgccgggag cacgtgcccgtgtcgatttacctggtcaatggcatcaagttgcagggtcagatcgagtcg ttcgaccagtacgtggttctcttgcggaacaccgtcacgcaaatggtctacaagcacgcc atttccaccatcgttccgggccgccccgtgcagttctccgccgcacctgcggacgagtcc gccgctccttga

DBGET integrated database retrieval system